![]() | Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
![]() | Superfamily f.23.2: Mitochondrial cytochrome c oxidase subunit VIa [81411] (1 family) ![]() automatically mapped to Pfam PF02046 |
![]() | Family f.23.2.1: Mitochondrial cytochrome c oxidase subunit VIa [81410] (2 proteins) |
![]() | Protein Mitochondrial cytochrome c oxidase subunit VIa [81409] (1 species) probably responsible for the dimerization of the mitochondrial cytochrome c oxidase |
![]() | Species Cow (Bos taurus) [TaxId:9913] [81408] (51 PDB entries) |
![]() | Domain d3ag3t_: 3ag3 T: [172109] Other proteins in same PDB: d3ag3a_, d3ag3b1, d3ag3b2, d3ag3c_, d3ag3d_, d3ag3e_, d3ag3f_, d3ag3h_, d3ag3i_, d3ag3j_, d3ag3k_, d3ag3l_, d3ag3m_, d3ag3n_, d3ag3o1, d3ag3o2, d3ag3p_, d3ag3q_, d3ag3r_, d3ag3s_, d3ag3u_, d3ag3v_, d3ag3w_, d3ag3x_, d3ag3y_, d3ag3z_ automated match to d1occg_ complexed with cdl, chd, cu, cua, dmu, hea, mg, na, no, pek, pgv, psc, tgl, unx, zn |
PDB Entry: 3ag3 (more details), 1.8 Å
SCOPe Domain Sequences for d3ag3t_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ag3t_ f.23.2.1 (T:) Mitochondrial cytochrome c oxidase subunit VIa {Cow (Bos taurus) [TaxId: 9913]} asaakgdhggtgartwrfltfglalpsvalctlnswlhsghrerpafipyhhlrirtkpf swgdgnhtffhnprvnplptgyek
Timeline for d3ag3t_:
![]() Domains from other chains: (mouse over for more information) d3ag3a_, d3ag3b1, d3ag3b2, d3ag3c_, d3ag3d_, d3ag3e_, d3ag3f_, d3ag3g_, d3ag3h_, d3ag3i_, d3ag3j_, d3ag3k_, d3ag3l_, d3ag3m_, d3ag3n_, d3ag3o1, d3ag3o2, d3ag3p_, d3ag3q_, d3ag3r_, d3ag3s_, d3ag3u_, d3ag3v_, d3ag3w_, d3ag3x_, d3ag3y_, d3ag3z_ |