Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.25: Cytochrome c oxidase subunit III-like [81453] (1 superfamily) core: 7 transmembrane helices organized into two bundles, one formed by the first two helices and the other by the rest |
Superfamily f.25.1: Cytochrome c oxidase subunit III-like [81452] (2 families) automatically mapped to Pfam PF00510 |
Family f.25.1.1: Cytochrome c oxidase subunit III-like [81451] (3 proteins) function unknown, possibly involved in the assembly or form the entrance to "oxygen" channel |
Protein Mitochondrial cytochrome c oxidase, subunit III [81445] (1 species) |
Species Cow (Bos taurus) [TaxId:9913] [81444] (52 PDB entries) |
Domain d3ag3p_: 3ag3 P: [172105] Other proteins in same PDB: d3ag3a_, d3ag3b1, d3ag3b2, d3ag3d_, d3ag3e_, d3ag3f_, d3ag3g_, d3ag3h_, d3ag3i_, d3ag3j_, d3ag3k_, d3ag3l_, d3ag3m_, d3ag3n_, d3ag3o1, d3ag3o2, d3ag3q_, d3ag3r_, d3ag3s_, d3ag3t_, d3ag3u_, d3ag3v_, d3ag3w_, d3ag3x_, d3ag3y_, d3ag3z_ automated match to d1occc_ complexed with cdl, chd, cu, cua, dmu, hea, mg, na, no, pek, pgv, psc, tgl, unx, zn |
PDB Entry: 3ag3 (more details), 1.8 Å
SCOPe Domain Sequences for d3ag3p_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ag3p_ f.25.1.1 (P:) Mitochondrial cytochrome c oxidase, subunit III {Cow (Bos taurus) [TaxId: 9913]} hqthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrdvi restfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptgih plnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqaseyy eapftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeaaawyw hfvdvvwlflyvsiywwgs
Timeline for d3ag3p_:
View in 3D Domains from other chains: (mouse over for more information) d3ag3a_, d3ag3b1, d3ag3b2, d3ag3c_, d3ag3d_, d3ag3e_, d3ag3f_, d3ag3g_, d3ag3h_, d3ag3i_, d3ag3j_, d3ag3k_, d3ag3l_, d3ag3m_, d3ag3n_, d3ag3o1, d3ag3o2, d3ag3q_, d3ag3r_, d3ag3s_, d3ag3t_, d3ag3u_, d3ag3v_, d3ag3w_, d3ag3x_, d3ag3y_, d3ag3z_ |