SCOPe 2.08: Domain d4pala_: 4pal A:

Lineage for d4pala_ (4pal A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.4: Parvalbumin [47492] (3 proteins)
   6-helices; array of 3 hairpins, closed
   made with two-helical hairpin and two EF-hands

6. Protein Parvalbumin [47495] (9 species)

7. Species Pike (Esox lucius) [TaxId:8010] [47497] (9 PDB entries)

8. Domain d4pala_: 4pal A: [17210]
   complexed with ca, mg

Details for d4pala_

PDB Entry: 4pal, 1.8 Å

PDB Description: ionic interactions with parvalbumins. crystal structure determination of pike 4.10 parvalbumin in four different ionic environments

PDB Compounds: (A:) parvalbumin

SCOPe Domain Sequences for d4pala_:

Sequence; same for both SEQRES and ATOM records:

>d4pala_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]}
sfaglkdadvaaalaacsaadsfkhkeffakvglaskslddvkkafyvidqdksgfieed
elklflqnfspsaraltdaetkafladgdkdgdgmigvdefaamika

Timeline for d4pala_:

• d4pala_ first appeared (with stable ids) in SCOP 1.55, called d4pal__
  
• d4pala_ appears in SCOPe 2.07