![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.51: Cytochrome c oxidase subunit h [47693] (1 superfamily) 4 helices; irregular array, disulfide-linked |
![]() | Superfamily a.51.1: Cytochrome c oxidase subunit h [47694] (2 families) ![]() |
![]() | Family a.51.1.1: Cytochrome c oxidase subunit h [47695] (2 proteins) |
![]() | Protein automated matches [190271] (1 species) not a true protein |
![]() | Species Cow (Bos taurus) [TaxId:9913] [187063] (26 PDB entries) |
![]() | Domain d3ag3h_: 3ag3 H: [172098] Other proteins in same PDB: d3ag3a_, d3ag3b1, d3ag3b2, d3ag3c_, d3ag3d_, d3ag3e_, d3ag3f_, d3ag3g_, d3ag3i_, d3ag3j_, d3ag3k_, d3ag3l_, d3ag3m_, d3ag3n_, d3ag3o1, d3ag3o2, d3ag3p_, d3ag3q_, d3ag3r_, d3ag3s_, d3ag3t_, d3ag3v_, d3ag3w_, d3ag3x_, d3ag3y_, d3ag3z_ automated match to d1ocrh_ complexed with cdl, chd, cu, cua, dmu, hea, mg, na, no, pek, pgv, psc, tgl, unx, zn |
PDB Entry: 3ag3 (more details), 1.8 Å
SCOPe Domain Sequences for d3ag3h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ag3h_ a.51.1.1 (H:) automated matches {Cow (Bos taurus) [TaxId: 9913]} kiknyqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpi swvstwddrraegtfpgki
Timeline for d3ag3h_:
![]() Domains from other chains: (mouse over for more information) d3ag3a_, d3ag3b1, d3ag3b2, d3ag3c_, d3ag3d_, d3ag3e_, d3ag3f_, d3ag3g_, d3ag3i_, d3ag3j_, d3ag3k_, d3ag3l_, d3ag3m_, d3ag3n_, d3ag3o1, d3ag3o2, d3ag3p_, d3ag3q_, d3ag3r_, d3ag3s_, d3ag3t_, d3ag3u_, d3ag3v_, d3ag3w_, d3ag3x_, d3ag3y_, d3ag3z_ |