Lineage for d3ag2s_ (3ag2 S:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2640990Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 2641212Superfamily g.41.5: Rubredoxin-like [57802] (4 families) (S)
  5. 2641384Family g.41.5.3: Cytochrome c oxidase Subunit F [57818] (2 proteins)
    membrane-anchored rubredoxin-like domain
    automatically mapped to Pfam PF01215
  6. 2641385Protein Cytochrome c oxidase Subunit F [57819] (1 species)
  7. 2641386Species Cow (Bos taurus) [TaxId:9913] [57820] (49 PDB entries)
  8. 2641396Domain d3ag2s_: 3ag2 S: [172084]
    Other proteins in same PDB: d3ag2a_, d3ag2b1, d3ag2b2, d3ag2c_, d3ag2d_, d3ag2e_, d3ag2g_, d3ag2h_, d3ag2i_, d3ag2j_, d3ag2k_, d3ag2l_, d3ag2m_, d3ag2n_, d3ag2o1, d3ag2o2, d3ag2p_, d3ag2q_, d3ag2r_, d3ag2t_, d3ag2u_, d3ag2v_, d3ag2w_, d3ag2x_, d3ag2y_, d3ag2z_
    automated match to d1occf_
    complexed with cdl, chd, cmo, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d3ag2s_

PDB Entry: 3ag2 (more details), 1.8 Å

PDB Description: bovine heart cytochrome c oxidase in the carbon monoxide-bound fully reduced state at 100 k
PDB Compounds: (S:) Cytochrome c oxidase subunit 5B

SCOPe Domain Sequences for d3ag2s_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ag2s_ g.41.5.3 (S:) Cytochrome c oxidase Subunit F {Cow (Bos taurus) [TaxId: 9913]}
asgggvptdeeqatglerevmlaarkgqdpynilapkatsgtkedpnlvpsitnkrivgc
iceednstviwfwlhkgeaqrcpscgthyklvphqlah

SCOPe Domain Coordinates for d3ag2s_:

Click to download the PDB-style file with coordinates for d3ag2s_.
(The format of our PDB-style files is described here.)

Timeline for d3ag2s_: