Lineage for d3ag2h_ (3ag2 H:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1737085Fold a.51: Cytochrome c oxidase subunit h [47693] (1 superfamily)
    4 helices; irregular array, disulfide-linked
  4. 1737086Superfamily a.51.1: Cytochrome c oxidase subunit h [47694] (1 family) (S)
  5. 1737087Family a.51.1.1: Cytochrome c oxidase subunit h [47695] (2 proteins)
  6. 1737109Protein automated matches [190271] (1 species)
    not a true protein
  7. 1737110Species Cow (Bos taurus) [TaxId:9913] [187063] (18 PDB entries)
  8. 1737115Domain d3ag2h_: 3ag2 H: [172074]
    Other proteins in same PDB: d3ag2a_, d3ag2b1, d3ag2b2, d3ag2c_, d3ag2d_, d3ag2e_, d3ag2f_, d3ag2g_, d3ag2i_, d3ag2j_, d3ag2k_, d3ag2l_, d3ag2m_, d3ag2n_, d3ag2o1, d3ag2o2, d3ag2p_, d3ag2q_, d3ag2r_, d3ag2s_, d3ag2t_, d3ag2v_, d3ag2w_, d3ag2x_, d3ag2y_, d3ag2z_
    automated match to d1ocrh_
    complexed with cdl, chd, cmo, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d3ag2h_

PDB Entry: 3ag2 (more details), 1.8 Å

PDB Description: bovine heart cytochrome c oxidase in the carbon monoxide-bound fully reduced state at 100 k
PDB Compounds: (H:) Cytochrome c oxidase subunit 6B1

SCOPe Domain Sequences for d3ag2h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ag2h_ a.51.1.1 (H:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
kiknyqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpi
swvstwddrraegtfpgki

SCOPe Domain Coordinates for d3ag2h_:

Click to download the PDB-style file with coordinates for d3ag2h_.
(The format of our PDB-style files is described here.)

Timeline for d3ag2h_: