Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.23.1: Mitochondrial cytochrome c oxidase subunit IV [81406] (1 family) automatically mapped to Pfam PF02936 |
Family f.23.1.1: Mitochondrial cytochrome c oxidase subunit IV [81405] (2 proteins) |
Protein automated matches [190270] (1 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [187062] (26 PDB entries) |
Domain d3ag2d_: 3ag2 D: [172070] Other proteins in same PDB: d3ag2a_, d3ag2b1, d3ag2b2, d3ag2c_, d3ag2e_, d3ag2f_, d3ag2g_, d3ag2h_, d3ag2i_, d3ag2j_, d3ag2k_, d3ag2l_, d3ag2m_, d3ag2n_, d3ag2o1, d3ag2o2, d3ag2p_, d3ag2r_, d3ag2s_, d3ag2t_, d3ag2u_, d3ag2v_, d3ag2w_, d3ag2x_, d3ag2y_, d3ag2z_ automated match to d1occd_ complexed with cdl, chd, cmo, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, zn |
PDB Entry: 3ag2 (more details), 1.8 Å
SCOPe Domain Sequences for d3ag2d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ag2d_ f.23.1.1 (D:) automated matches {Cow (Bos taurus) [TaxId: 9913]} svvksedyalpsyvdrrdyplpdvahvknlsasqkalkekekaswsslsidekvelyrlk fkesfaemnrstnewktvvgaamffigftallliwekhyvygpiphtfeeewvakqtkrm ldmkvapiqgfsakwdydknewkk
Timeline for d3ag2d_:
View in 3D Domains from other chains: (mouse over for more information) d3ag2a_, d3ag2b1, d3ag2b2, d3ag2c_, d3ag2e_, d3ag2f_, d3ag2g_, d3ag2h_, d3ag2i_, d3ag2j_, d3ag2k_, d3ag2l_, d3ag2m_, d3ag2n_, d3ag2o1, d3ag2o2, d3ag2p_, d3ag2q_, d3ag2r_, d3ag2s_, d3ag2t_, d3ag2u_, d3ag2v_, d3ag2w_, d3ag2x_, d3ag2y_, d3ag2z_ |