Lineage for d3ag2c_ (3ag2 C:)

  1. Root: SCOPe 2.04
  2. 1695624Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1698889Fold f.25: Cytochrome c oxidase subunit III-like [81453] (1 superfamily)
    core: 7 transmembrane helices organized into two bundles, one formed by the first two helices and the other by the rest
  4. 1698890Superfamily f.25.1: Cytochrome c oxidase subunit III-like [81452] (1 family) (S)
    automatically mapped to Pfam PF00510
  5. 1698891Family f.25.1.1: Cytochrome c oxidase subunit III-like [81451] (3 proteins)
    function unknown, possibly involved in the assembly or form the entrance to "oxygen" channel
  6. 1698904Protein Mitochondrial cytochrome c oxidase, subunit III [81445] (1 species)
  7. 1698905Species Cow (Bos taurus) [TaxId:9913] [81444] (26 PDB entries)
  8. 1698912Domain d3ag2c_: 3ag2 C: [172069]
    Other proteins in same PDB: d3ag2a_, d3ag2b1, d3ag2b2, d3ag2d_, d3ag2e_, d3ag2f_, d3ag2g_, d3ag2h_, d3ag2i_, d3ag2j_, d3ag2k_, d3ag2l_, d3ag2m_, d3ag2n_, d3ag2o1, d3ag2o2, d3ag2q_, d3ag2r_, d3ag2s_, d3ag2t_, d3ag2u_, d3ag2v_, d3ag2w_, d3ag2x_, d3ag2y_, d3ag2z_
    automated match to d1occc_
    complexed with cdl, chd, cmo, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d3ag2c_

PDB Entry: 3ag2 (more details), 1.8 Å

PDB Description: bovine heart cytochrome c oxidase in the carbon monoxide-bound fully reduced state at 100 k
PDB Compounds: (C:) Cytochrome c oxidase subunit 3

SCOPe Domain Sequences for d3ag2c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ag2c_ f.25.1.1 (C:) Mitochondrial cytochrome c oxidase, subunit III {Cow (Bos taurus) [TaxId: 9913]}
hqthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrdvi
restfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptgih
plnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqaseyy
eapftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeaaawyw
hfvdvvwlflyvsiywwgs

SCOPe Domain Coordinates for d3ag2c_:

Click to download the PDB-style file with coordinates for d3ag2c_.
(The format of our PDB-style files is described here.)

Timeline for d3ag2c_: