Lineage for d3ag1s_ (3ag1 S:)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1065992Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 1066160Superfamily g.41.5: Rubredoxin-like [57802] (3 families) (S)
  5. 1066318Family g.41.5.3: Cytochrome c oxidase Subunit F [57818] (1 protein)
    membrane-anchored rubredoxin-like domain
  6. 1066319Protein Cytochrome c oxidase Subunit F [57819] (1 species)
  7. 1066320Species Cow (Bos taurus) [TaxId:9913] [57820] (22 PDB entries)
  8. 1066344Domain d3ag1s_: 3ag1 S: [172060]
    Other proteins in same PDB: d3ag1a_, d3ag1c_, d3ag1d_, d3ag1e_, d3ag1g_, d3ag1h_, d3ag1i_, d3ag1j_, d3ag1k_, d3ag1l_, d3ag1m_, d3ag1n_, d3ag1p_, d3ag1q_, d3ag1r_, d3ag1t_, d3ag1u_, d3ag1v_, d3ag1w_, d3ag1x_, d3ag1y_, d3ag1z_
    automated match to d1occf_
    complexed with cdl, chd, cmo, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d3ag1s_

PDB Entry: 3ag1 (more details), 2.2 Å

PDB Description: Bovine Heart Cytochrome c Oxidase in the Carbon Monoxide-bound Fully Reduced State at 280 K
PDB Compounds: (S:) Cytochrome c oxidase subunit 5B

SCOPe Domain Sequences for d3ag1s_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ag1s_ g.41.5.3 (S:) Cytochrome c oxidase Subunit F {Cow (Bos taurus) [TaxId: 9913]}
asgggvptdeeqatglerevmlaarkgqdpynilapkatsgtkedpnlvpsitnkrivgc
iceednstviwfwlhkgeaqrcpscgthyklvphqlah

SCOPe Domain Coordinates for d3ag1s_:

Click to download the PDB-style file with coordinates for d3ag1s_.
(The format of our PDB-style files is described here.)

Timeline for d3ag1s_: