Lineage for d3ag1h_ (3ag1 H:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2000510Fold a.51: Cytochrome c oxidase subunit h [47693] (1 superfamily)
    4 helices; irregular array, disulfide-linked
  4. 2000511Superfamily a.51.1: Cytochrome c oxidase subunit h [47694] (1 family) (S)
  5. 2000512Family a.51.1.1: Cytochrome c oxidase subunit h [47695] (2 proteins)
  6. 2000550Protein automated matches [190271] (1 species)
    not a true protein
  7. 2000551Species Cow (Bos taurus) [TaxId:9913] [187063] (19 PDB entries)
  8. 2000570Domain d3ag1h_: 3ag1 H: [172050]
    Other proteins in same PDB: d3ag1a_, d3ag1b1, d3ag1b2, d3ag1c_, d3ag1d_, d3ag1e_, d3ag1f_, d3ag1g_, d3ag1i_, d3ag1j_, d3ag1k_, d3ag1l_, d3ag1m_, d3ag1n_, d3ag1o1, d3ag1o2, d3ag1p_, d3ag1q_, d3ag1r_, d3ag1s_, d3ag1t_, d3ag1v_, d3ag1w_, d3ag1x_, d3ag1y_, d3ag1z_
    automated match to d1ocrh_
    complexed with cdl, chd, cmo, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d3ag1h_

PDB Entry: 3ag1 (more details), 2.2 Å

PDB Description: Bovine Heart Cytochrome c Oxidase in the Carbon Monoxide-bound Fully Reduced State at 280 K
PDB Compounds: (H:) Cytochrome c oxidase subunit 6B1

SCOPe Domain Sequences for d3ag1h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ag1h_ a.51.1.1 (H:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
kiknyqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpi
swvstwddrraegtfpgki

SCOPe Domain Coordinates for d3ag1h_:

Click to download the PDB-style file with coordinates for d3ag1h_.
(The format of our PDB-style files is described here.)

Timeline for d3ag1h_: