| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
| Protein automated matches [190069] (319 species) not a true protein |
| Species Sphingomonas sp. [TaxId:90322] [189409] (6 PDB entries) |
| Domain d3afnb_: 3afn B: [172039] automated match to d1spxa_ complexed with nap, tbu |
PDB Entry: 3afn (more details), 1.63 Å
SCOPe Domain Sequences for d3afnb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3afnb_ c.2.1.0 (B:) automated matches {Sphingomonas sp. [TaxId: 90322]}
fpdlkgkrvlitgssqgiglatarlfaragakvglhgrkapanidetiasmradggdaaf
faadlatseacqqlvdefvakfggidvlinnagglvgrkplpeiddtfydavmdanirsv
vmttkfalphlaaaakasgqtsavistgsiaghtgggpgaglygaakaflhnvhknwvdf
htkdgvrfnivspgtvdtafhadktqdvrdrisngipmgrfgtaeemapaflffashlas
gyitgqvldinggqykh
Timeline for d3afnb_: