Lineage for d3afna_ (3afn A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1830524Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1830525Protein automated matches [190069] (203 species)
    not a true protein
  7. 1832192Species Sphingomonas sp. [TaxId:90322] [189409] (6 PDB entries)
  8. 1832195Domain d3afna_: 3afn A: [172038]
    automated match to d1spxa_
    complexed with nap, tbu

Details for d3afna_

PDB Entry: 3afn (more details), 1.63 Å

PDB Description: Crystal structure of aldose reductase A1-R complexed with NADP
PDB Compounds: (A:) carbonyl reductase

SCOPe Domain Sequences for d3afna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3afna_ c.2.1.0 (A:) automated matches {Sphingomonas sp. [TaxId: 90322]}
fpdlkgkrvlitgssqgiglatarlfaragakvglhgrkapanidetiasmradggdaaf
faadlatseacqqlvdefvakfggidvlinnagglvgrkplpeiddtfydavmdanirsv
vmttkfalphlaaaakasgqtsavistgsiaghtgggpgaglygaakaflhnvhknwvdf
htkdgvrfnivspgtvdtafhadktqdvrdrisngipmgrfgtaeemapaflffashlas
gyitgqvldinggqykh

SCOPe Domain Coordinates for d3afna_:

Click to download the PDB-style file with coordinates for d3afna_.
(The format of our PDB-style files is described here.)

Timeline for d3afna_: