SCOPe 2.05: Domain d3af9x_: 3af9 X:

Lineage for d3af9x_ (3af9 X:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.1: Ferritin [47241] (10 proteins)

6. Protein (Apo)ferritin [47246] (8 species)

7. Species Horse (Equus caballus), L chain [TaxId:9796] [47248] (52 PDB entries)

8. Domain d3af9x_: 3af9 X: [172033]
   automated match to d1hrsa_
   complexed with cd, edo, pd, pll, so4

Details for d3af9x_

PDB Entry: 3af9, 1.85 Å

PDB Description: crystal structure of pd(allyl)/apo-c48afr

PDB Compounds: (X:) ferritin light chain

SCOPe Domain Sequences for d3af9x_:

Sequence; same for both SEQRES and ATOM records:

>d3af9x_ a.25.1.1 (X:) (Apo)ferritin {Horse (Equus caballus), L chain [TaxId: 9796]}
sqirqnysteveaavnrlvnlylrasytylslgfyfdrddvalegvahffrelaeekreg
aerllkmqnqrggralfqdlqkpsqdewgttldamkaaivlekslnqalldlhalgsaqa
dphlcdfleshfldeevklikkmgdhltniqrlvgsqaglgeylferltlk

Timeline for d3af9x_:

• d3af9x_ first appeared in SCOPe 2.01
  
• d3af9x_ appears in SCOPe 2.04
  
• d3af9x_ appears in SCOPe 2.06
  
• d3af9x_ appears in the current release, SCOPe 2.08