Lineage for d3af4a_ (3af4 A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 987024Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 987025Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 990511Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 990512Protein automated matches [190123] (20 species)
    not a true protein
  7. 990595Species Mycobacterium tuberculosis [TaxId:83332] [187746] (10 PDB entries)
  8. 990604Domain d3af4a_: 3af4 A: [172030]
    automated match to d1esma_
    complexed with gcp, gol

Details for d3af4a_

PDB Entry: 3af4 (more details), 2.6 Å

PDB Description: Pantothenate kinase from Mycobacterium tuberculosis (MtPanK) in complex with GMPPCP
PDB Compounds: (A:) pantothenate kinase

SCOPe Domain Sequences for d3af4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3af4a_ c.37.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
epspyvefdrrqwralrmstplalteeelvglrglgeqidlleveevylplarlihlqva
arqrlfaataeflgepqqnpdrpvpfiigvagsvavgksttarvlqallarwdhhprvdl
vttdgflypnaelqrrnlmhrkgfpesynrralmrfvtsvksgsdyacapvyshlhydii
pgaeqvvrhpdilileglnvlqtgptlmvsdlfdfslyvdariedieqwyvsrflamrtt
afadpeshfhhyaafsdsqavvaareiwrtinrpnlvenilptrpratlvlrkdadhsin
rlrlrkl

SCOPe Domain Coordinates for d3af4a_:

Click to download the PDB-style file with coordinates for d3af4a_.
(The format of our PDB-style files is described here.)

Timeline for d3af4a_: