Lineage for d3af1a_ (3af1 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2479613Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2479614Protein automated matches [190123] (156 species)
    not a true protein
  7. 2480632Species Mycobacterium tuberculosis [TaxId:83332] [187746] (23 PDB entries)
  8. 2480655Domain d3af1a_: 3af1 A: [172027]
    automated match to d1esma_
    complexed with cl, flc, gdp, gol

Details for d3af1a_

PDB Entry: 3af1 (more details), 2.5 Å

PDB Description: Pantothenate kinase from Mycobacterium tuberculosis (MtPanK) in complex with GDP
PDB Compounds: (A:) pantothenate kinase

SCOPe Domain Sequences for d3af1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3af1a_ c.37.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
epspyvefdrrqwralrmstplalteeelvglrglgeqidlleveevylplarlihlqva
arqrlfaataeflgepqqnpdrpvpfiigvagsvavgksttarvlqallarwdhhprvdl
vttdgflypnaelqrrnlmhrkgfpesynrralmrfvtsvksgsdyacapvyshlhydii
pgaeqvvrhpdilileglnvlqtgptlmvsdlfdfslyvdariedieqwyvsrflamrtt
afadpeshfhhyaafsdsqavvaareiwrtinrpnlvenilptrpratlvlrkdadhsin
rlrlrkl

SCOPe Domain Coordinates for d3af1a_:

Click to download the PDB-style file with coordinates for d3af1a_.
(The format of our PDB-style files is described here.)

Timeline for d3af1a_: