Lineage for d3adta_ (3adt A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2009403Protein automated matches [190059] (14 species)
    not a true protein
  7. 2009425Species Human (Homo sapiens) [TaxId:9606] [187214] (173 PDB entries)
  8. 2009613Domain d3adta_: 3adt A: [172015]
    automated match to d1nyxa_
    protein/DNA complex; complexed with hid

Details for d3adta_

PDB Entry: 3adt (more details), 2.7 Å

PDB Description: Human PPARgamma ligand-binding domain in complex with 5-hydroxy-indole acetate
PDB Compounds: (A:) Peroxisome proliferator-activated receptor gamma

SCOPe Domain Sequences for d3adta_:

Sequence, based on SEQRES records: (download)

>d3adta_ a.123.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qlnpesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedki
kfkhitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygv
heiiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnaleldds
dlaifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdl
rqivtehvqllqvikktetdmslhpllqeiykdl

Sequence, based on observed residues (ATOM records): (download)

>d3adta_ a.123.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qlnpesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedev
airifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslmnkd
gvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviilsgdr
pgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqllqvik
ktetdmslhpllqeiykdl

SCOPe Domain Coordinates for d3adta_:

Click to download the PDB-style file with coordinates for d3adta_.
(The format of our PDB-style files is described here.)

Timeline for d3adta_: