![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.50: dsRBD-like [54767] (5 superfamilies) alpha-beta(3)-alpha; 2 layers: alpha/beta |
![]() | Superfamily d.50.1: dsRNA-binding domain-like [54768] (4 families) ![]() |
![]() | Family d.50.1.1: Double-stranded RNA-binding domain (dsRBD) [54769] (13 proteins) Pfam PF00035 |
![]() | Protein automated matches [191157] (3 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [189334] (1 PDB entry) |
![]() | Domain d3adla_: 3adl A: [172012] automated match to d2cpna1 protein/RNA complex |
PDB Entry: 3adl (more details), 2.2 Å
SCOPe Domain Sequences for d3adla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3adla_ d.50.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} glvprgshevgalqelvvqkgwrlpeytvtqesgpahrkeftmtcrverfieigsgtskk lakrnaaakmllrvht
Timeline for d3adla_: