SCOPe 2.08: Domain d3adla1: 3adl A:161-227

Lineage for d3adla1 (3adl A:161-227)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.50: dsRBD-like [54767] (5 superfamilies)
   alpha-beta(3)-alpha; 2 layers: alpha/beta

4. Superfamily d.50.1: dsRNA-binding domain-like [54768] (4 families)

5. Family d.50.1.1: Double-stranded RNA-binding domain (dsRBD) [54769] (13 proteins)
   Pfam PF00035

6. Protein automated matches [191157] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189334] (1 PDB entry)

8. Domain d3adla1: 3adl A:161-227 [172012]
   Other proteins in same PDB: d3adla2
   automated match to d2cpna1
   protein/RNA complex

Details for d3adla1

PDB Entry: 3adl, 2.2 Å

PDB Description: Structure of TRBP2 and its molecule implications for miRNA processing

PDB Compounds: (A:) RISC-loading complex subunit TARBP2

SCOPe Domain Sequences for d3adla1:

Sequence; same for both SEQRES and ATOM records:

>d3adla1 d.50.1.1 (A:161-227) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vgalqelvvqkgwrlpeytvtqesgpahrkeftmtcrverfieigsgtskklakrnaaak
mllrvht

Timeline for d3adla1:

• d3adla1 first appeared in SCOPe 2.01, called d3adla_
  
• d3adla1 appears in SCOPe 2.07