SCOPe 2.05: Domain d3adfb_: 3adf B:

Lineage for d3adfb_ (3adf B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)

6. Protein Green fluorescent protein, GFP [54513] (4 species)

7. Species Galaxea fascicularis [TaxId:46745] [190027] (1 PDB entry)

8. Domain d3adfb_: 3adf B: [172011]
   automated match to d1mova_

Details for d3adfb_

PDB Entry: 3adf, 2.2 Å

PDB Description: Crystal structure of a monomeric green fluorescent protein, Azami-Green (mAG)

PDB Compounds: (B:) Monomeric Azami Green

SCOPe Domain Sequences for d3adfb_:

Sequence; same for both SEQRES and ATOM records:

>d3adfb_ d.22.1.1 (B:) Green fluorescent protein, GFP {Galaxea fascicularis [TaxId: 46745]}
kpemkiklcmrgtvnghnfviegegkgnpyegtqildlnvtegaplpfaydilttvfqyg
nraftkypadiqdyfkqtfpegyhwersmtyedqgictatsnismrgdcffydirfdgtn
fppngpvmqkktlkwepstekmyvedgvlkgdvnmrllleggghyrcdfkttykakkevr
lpdahkidhrieilkhdkdynkvklyenavar

Timeline for d3adfb_:

• d3adfb_ first appeared in SCOPe 2.01
  
• d3adfb_ appears in SCOPe 2.04
  
• d3adfb_ appears in SCOPe 2.06
  
• d3adfb_ appears in the current release, SCOPe 2.08