Lineage for d3adfa_ (3adf A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2184480Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2184481Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2184482Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 2184486Protein Green fluorescent protein, GFP [54513] (4 species)
  7. 2184489Species Galaxea fascicularis [TaxId:46745] [190027] (1 PDB entry)
  8. 2184490Domain d3adfa_: 3adf A: [172010]
    automated match to d1mova_

Details for d3adfa_

PDB Entry: 3adf (more details), 2.2 Å

PDB Description: Crystal structure of a monomeric green fluorescent protein, Azami-Green (mAG)
PDB Compounds: (A:) Monomeric Azami Green

SCOPe Domain Sequences for d3adfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3adfa_ d.22.1.1 (A:) Green fluorescent protein, GFP {Galaxea fascicularis [TaxId: 46745]}
ikpemkiklcmrgtvnghnfviegegkgnpyegtqildlnvtegaplpfaydilttvfqy
gnraftkypadiqdyfkqtfpegyhwersmtyedqgictatsnismrgdcffydirfdgt
nfppngpvmqkktlkwepstekmyvedgvlkgdvnmrllleggghyrcdfkttykakkev
rlpdahkidhrieilkhdkdynkvklyenavar

SCOPe Domain Coordinates for d3adfa_:

Click to download the PDB-style file with coordinates for d3adfa_.
(The format of our PDB-style files is described here.)

Timeline for d3adfa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3adfb_