| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
Superfamily d.22.1: GFP-like [54511] (3 families) ![]() |
| Family d.22.1.1: Fluorescent proteins [54512] (6 proteins) |
| Protein Green fluorescent protein, GFP [54513] (4 species) |
| Species Galaxea fascicularis [TaxId:46745] [190027] (1 PDB entry) |
| Domain d3adfa_: 3adf A: [172010] automated match to d1mova_ |
PDB Entry: 3adf (more details), 2.2 Å
SCOPe Domain Sequences for d3adfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3adfa_ d.22.1.1 (A:) Green fluorescent protein, GFP {Galaxea fascicularis [TaxId: 46745]}
ikpemkiklcmrgtvnghnfviegegkgnpyegtqildlnvtegaplpfaydilttvfqy
gnraftkypadiqdyfkqtfpegyhwersmtyedqgictatsnismrgdcffydirfdgt
nfppngpvmqkktlkwepstekmyvedgvlkgdvnmrllleggghyrcdfkttykakkev
rlpdahkidhrieilkhdkdynkvklyenavar
Timeline for d3adfa_: