Lineage for d3ad5a_ (3ad5 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2979693Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2981879Protein Lymphocyte kinase (lck) [56153] (1 species)
    PTK group; Src subfamily; non-membrane spanning protein tyrosine kinase
  7. 2981880Species Human (Homo sapiens) [TaxId:9606] [56154] (35 PDB entries)
  8. 2981883Domain d3ad5a_: 3ad5 A: [172007]
    automated match to d1qpca_
    complexed with 5pb, dms, mpd, so4

Details for d3ad5a_

PDB Entry: 3ad5 (more details), 2 Å

PDB Description: Crystal structure of Triazolone derivative bound to the kinase domain of human LCK, (auto-phosphorylated on TYR394)
PDB Compounds: (A:) Proto-oncogene tyrosine-protein kinase LCK

SCOPe Domain Sequences for d3ad5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ad5a_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]}
qkpwwedewevpretlklverlgagqfgevwmgyynghtkvavkslkqgsmspdaflaea
nlmkqlqhqrlvrlyavvtqepiyiiteymengslvdflktpsgikltinklldmaaqia
egmafieernyihrdlraanilvsdtlsckiadfglarliedneytaregakfpikwtap
eainygtftiksdvwsfgillteivthgripypgmtnpeviqnlergyrmvrpdncpeel
yqlmrlcwkerpedrptfdylrsvledfftate

SCOPe Domain Coordinates for d3ad5a_:

Click to download the PDB-style file with coordinates for d3ad5a_.
(The format of our PDB-style files is described here.)

Timeline for d3ad5a_: