Lineage for d3acla_ (3acl A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2080271Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2080272Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2080679Family b.82.1.12: Pirin-like [101984] (3 proteins)
    Share a common two-domain fold with the 7S protein; there is a metal-binding site in the N-terminal domain similar to the metal-binding site of germin
  6. 2080692Protein automated matches [191170] (1 species)
    not a true protein
  7. 2080693Species Human (Homo sapiens) [TaxId:9606] [189408] (2 PDB entries)
  8. 2080695Domain d3acla_: 3acl A: [172005]
    automated match to d1j1la_
    complexed with 3f1, fe2

Details for d3acla_

PDB Entry: 3acl (more details), 2.35 Å

PDB Description: Crystal Structure of Human Pirin in complex with Triphenyl Compound
PDB Compounds: (A:) Pirin

SCOPe Domain Sequences for d3acla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3acla_ b.82.1.12 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sskkvtlsvlsreqsegvgarvrrsigrpelknldpfllfdefkggrpggfpdhphrgfe
tvsylleggsmahedfcghtgkmnpgdlqwmtagrgilhaempcseepahglqlwvnlrs
sekmvepqyqelkseeipkpskdgvtvavisgealgikskvytrtptlyldfkldpgakh
sqpipkgwtsfiytisgdvyigpddaqqkiephhtavlgegdsvqvenkdpkrshfvlia
geplrepviqhgpfvmntneeisqaildfrnakngferaktwkskign

SCOPe Domain Coordinates for d3acla_:

Click to download the PDB-style file with coordinates for d3acla_.
(The format of our PDB-style files is described here.)

Timeline for d3acla_: