SCOPe 2.03: Domain d3acba_: 3acb A:

Lineage for d3acba_ (3acb A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.0: automated matches [191528] (1 protein)
   not a true family

6. Protein automated matches [190891] (18 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:300852] [189206] (3 PDB entries)

8. Domain d3acba_: 3acb A: [172000]
   automated match to d1r3ua_
   complexed with dio

Details for d3acba_

PDB Entry: 3acb, 2.06 Å

PDB Description: Crystal structure of hypoxanthine-guanine phosphoribosyltransferase from Thermus thermophilus HB8

PDB Compounds: (A:) hypoxanthine-guanine phosphoribosyltransferase

SCOPe Domain Sequences for d3acba_:

Sequence, based on SEQRES records:

>d3acba_ c.61.1.0 (A:) automated matches {Thermus thermophilus [TaxId: 300852]}
gmftpgngpvqisaeaikkrveelggeiardyqgktphlicvlngafifmadlvraiplp
ltmdfiaissygnafkssgevellkdlrlpihgrdvivvedivdtgltlsylldyleark
pasvrvaallskpsrrqvevpihylgfeiedayvygygldraqfdrnlpfitsirpee

Sequence, based on observed residues (ATOM records):

>d3acba_ c.61.1.0 (A:) automated matches {Thermus thermophilus [TaxId: 300852]}
gmftpgngpvqisaeaikkrveelggeiardyqgktphlicvlngafifmadlvraiplp
ltmdfiaisellkdlrlpihgrdvivvedivdtgltlsylldylearkpasvrvaallsk
psrrqvevpihylgfeiedayvygygldraqfdrnlpfitsirpee

Timeline for d3acba_:

• d3acba_ first appeared in SCOPe 2.01
  
• d3acba_ appears in SCOPe 2.02
  
• d3acba_ appears in SCOPe 2.04
  
• d3acba_ appears in the current release, SCOPe 2.08