Lineage for d3abmw_ (3abm W:)

  1. Root: SCOPe 2.05
  2. 1955192Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1957421Fold f.23: Single transmembrane helix [81407] (40 superfamilies)
    not a true fold
  4. 1957600Superfamily f.23.4: Mitochondrial cytochrome c oxidase subunit VIIa [81419] (1 family) (S)
    automatically mapped to Pfam PF02238
  5. 1957601Family f.23.4.1: Mitochondrial cytochrome c oxidase subunit VIIa [81418] (2 proteins)
  6. 1957602Protein Mitochondrial cytochrome c oxidase subunit VIIa [81417] (1 species)
    function unknown, probably acts as a regulator or is required for the assembly
  7. 1957603Species Cow (Bos taurus) [TaxId:9913] [81416] (26 PDB entries)
  8. 1957613Domain d3abmw_: 3abm W: [171990]
    Other proteins in same PDB: d3abma_, d3abmb1, d3abmb2, d3abmc_, d3abmd_, d3abme_, d3abmf_, d3abmg_, d3abmh_, d3abmi_, d3abmk_, d3abml_, d3abmm_, d3abmn_, d3abmo1, d3abmo2, d3abmp_, d3abmq_, d3abmr_, d3abms_, d3abmt_, d3abmu_, d3abmv_, d3abmx_, d3abmy_, d3abmz_
    automated match to d1ocrj_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, per, pgv, psc, tgl, unx, zn

Details for d3abmw_

PDB Entry: 3abm (more details), 1.95 Å

PDB Description: Bovine heart cytochrome c oxidase at the fully oxidized state (200-s X-ray exposure dataset)
PDB Compounds: (W:) Cytochrome c oxidase polypeptide 7A1

SCOPe Domain Sequences for d3abmw_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3abmw_ f.23.4.1 (W:) Mitochondrial cytochrome c oxidase subunit VIIa {Cow (Bos taurus) [TaxId: 9913]}
fenrvaekqklfqednglpvhlkggatdnilyrvtmtlclggtlyslyclgwasfph

SCOPe Domain Coordinates for d3abmw_:

Click to download the PDB-style file with coordinates for d3abmw_.
(The format of our PDB-style files is described here.)

Timeline for d3abmw_: