Lineage for d1b8la_ (1b8l A:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 355182Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 355183Superfamily a.39.1: EF-hand [47473] (10 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 355316Family a.39.1.4: Parvalbumin [47492] (2 proteins)
    6-helices; array of 3 hairpins, closed
    made with two-helical hairpin and two EF-hands
  6. 355321Protein Parvalbumin [47495] (6 species)
  7. 355322Species Carp (Cyprinus carpio) [TaxId:7962] [47496] (7 PDB entries)
  8. 355325Domain d1b8la_: 1b8l A: [17199]
    complexed with ca, co3; mutant

Details for d1b8la_

PDB Entry: 1b8l (more details), 1.7 Å

PDB Description: calcium-bound d51a/e101d/f102w triple mutant of beta carp parvalbumin

SCOP Domain Sequences for d1b8la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b8la_ a.39.1.4 (A:) Parvalbumin {Carp (Cyprinus carpio)}
afagvlndadiaaaleackaadsfnhkaffakvgltsksaddvkkafaiiaqdksgfiee
delklflqnfkadaraltdgetktflkagdsdgdgkigvddwtalvka

SCOP Domain Coordinates for d1b8la_:

Click to download the PDB-style file with coordinates for d1b8la_.
(The format of our PDB-style files is described here.)

Timeline for d1b8la_: