Lineage for d3ablu_ (3abl U:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1737085Fold a.51: Cytochrome c oxidase subunit h [47693] (1 superfamily)
    4 helices; irregular array, disulfide-linked
  4. 1737086Superfamily a.51.1: Cytochrome c oxidase subunit h [47694] (1 family) (S)
  5. 1737087Family a.51.1.1: Cytochrome c oxidase subunit h [47695] (2 proteins)
  6. 1737109Protein automated matches [190271] (1 species)
    not a true protein
  7. 1737110Species Cow (Bos taurus) [TaxId:9913] [187063] (18 PDB entries)
  8. 1737128Domain d3ablu_: 3abl U: [171964]
    Other proteins in same PDB: d3abla_, d3ablb1, d3ablb2, d3ablc_, d3abld_, d3able_, d3ablf_, d3ablg_, d3abli_, d3ablj_, d3ablk_, d3abll_, d3ablm_, d3abln_, d3ablo1, d3ablo2, d3ablp_, d3ablq_, d3ablr_, d3abls_, d3ablt_, d3ablv_, d3ablw_, d3ablx_, d3ably_, d3ablz_
    automated match to d1ocrh_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, per, pgv, psc, tgl, unx, zn

Details for d3ablu_

PDB Entry: 3abl (more details), 2.1 Å

PDB Description: Bovine heart cytochrome c oxidase at the fully oxidized state (15-s X-ray exposure dataset)
PDB Compounds: (U:) Cytochrome c oxidase subunit 6B1

SCOPe Domain Sequences for d3ablu_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ablu_ a.51.1.1 (U:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
yqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpiswvs
twddrraegtfpgki

SCOPe Domain Coordinates for d3ablu_:

Click to download the PDB-style file with coordinates for d3ablu_.
(The format of our PDB-style files is described here.)

Timeline for d3ablu_: