SCOPe 2.07: Domain d3abky_: 3abk Y:

Lineage for d3abky_ (3abk Y:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold

4. Superfamily f.23.6: Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa) [81427] (1 family)
   automatically mapped to Pfam PF02935

5. Family f.23.6.1: Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa) [81426] (2 proteins)

6. Protein Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa) [81425] (1 species)
   function unknown, probably acts as a regulator or is required for the assembly

7. Species Cow (Bos taurus) [TaxId:9913] [81424] (49 PDB entries)

8. Domain d3abky_: 3abk Y: [171944]
   Other proteins in same PDB: d3abka_, d3abkb1, d3abkb2, d3abkc_, d3abkd_, d3abke_, d3abkf_, d3abkg_, d3abkh_, d3abki_, d3abkj_, d3abkk_, d3abkm_, d3abkn_, d3abko1, d3abko2, d3abkp_, d3abkq_, d3abkr_, d3abks_, d3abkt_, d3abku_, d3abkv_, d3abkw_, d3abkx_, d3abkz_
   automated match to d1occl_
   complexed with cdl, chd, cu, cua, dmu, hea, mg, na, no, pek, pgv, psc, tgl, unx, zn

Details for d3abky_

PDB Entry: 3abk, 2 Å

PDB Description: Bovine heart cytochrome c oxidase at the NO-bound fully reduced state (50K)

PDB Compounds: (Y:) Cytochrome c oxidase subunit 7C

SCOPe Domain Sequences for d3abky_:

Sequence; same for both SEQRES and ATOM records:

>d3abky_ f.23.6.1 (Y:) Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa) {Cow (Bos taurus) [TaxId: 9913]}
hyeegpgknipfsvenkwrllammtlffgsgfaapffivrhqllkk

Timeline for d3abky_:

• d3abky_ first appeared in SCOPe 2.01
  
• d3abky_ appears in SCOPe 2.06
  
• d3abky_ appears in the current release, SCOPe 2.08