Lineage for d1bmob1 (1bmo B:136-286)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 768455Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 768456Superfamily a.39.1: EF-hand [47473] (11 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 768633Family a.39.1.3: Osteonectin [47489] (1 protein)
    5 helices; two EF-hands plus one of additional helices in the N-terminal part
  6. 768634Protein C-terminal (EC) domain of BM-40/SPARC/osteonectin [47490] (1 species)
  7. 768635Species Human (Homo sapiens) [TaxId:9606] [47491] (3 PDB entries)
  8. 768640Domain d1bmob1: 1bmo B:136-286 [17194]
    Other proteins in same PDB: d1bmoa2, d1bmoa3, d1bmob2, d1bmob3
    complexed with ca, nag

Details for d1bmob1

PDB Entry: 1bmo (more details), 3.1 Å

PDB Description: bm-40, fs/ec domain pair
PDB Compounds: (B:) bm-40

SCOP Domain Sequences for d1bmob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bmob1 a.39.1.3 (B:136-286) C-terminal (EC) domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]}
ppcldseltefplrmrdwlknvlvtlyerdednnlltekqklrvkkihenekrleagdhp
vellardfeknynmyifpvhwqfgqldqhpidgylshtelaplraplipmehcttrffet
cdldndkyialdewagcfgikqkdidkdlvi

SCOP Domain Coordinates for d1bmob1:

Click to download the PDB-style file with coordinates for d1bmob1.
(The format of our PDB-style files is described here.)

Timeline for d1bmob1: