![]() | Class a: All alpha proteins [46456] (226 folds) |
![]() | Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
![]() | Superfamily a.39.1: EF-hand [47473] (10 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
![]() | Family a.39.1.3: Osteonectin [47489] (1 protein) 5 helices; two EF-hands plus one of additional helices in the N-terminal part |
![]() | Protein C-terminal (EC) domain of BM-40/SPARC/osteonectin [47490] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [47491] (3 PDB entries) |
![]() | Domain d1bmob1: 1bmo B:136-286 [17194] Other proteins in same PDB: d1bmoa2, d1bmoa3, d1bmob2, d1bmob3 complexed with ca, nag |
PDB Entry: 1bmo (more details), 3.1 Å
SCOP Domain Sequences for d1bmob1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bmob1 a.39.1.3 (B:136-286) C-terminal (EC) domain of BM-40/SPARC/osteonectin {Human (Homo sapiens)} ppcldseltefplrmrdwlknvlvtlyerdednnlltekqklrvkkihenekrleagdhp vellardfeknynmyifpvhwqfgqldqhpidgylshtelaplraplipmehcttrffet cdldndkyialdewagcfgikqkdidkdlvi
Timeline for d1bmob1: