Lineage for d1bmob1 (1bmo B:136-286)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 3180Fold a.39: EF Hand-like [47472] (3 superfamilies)
  4. 3181Superfamily a.39.1: EF-hand [47473] (7 families) (S)
  5. 3243Family a.39.1.3: Osteonectin [47489] (1 protein)
  6. 3244Protein C-terminal (EC) domain of BM-40/SPARC/osteonectin [47490] (1 species)
  7. 3245Species Human (Homo sapiens) [TaxId:9606] [47491] (3 PDB entries)
  8. 3250Domain d1bmob1: 1bmo B:136-286 [17194]
    Other proteins in same PDB: d1bmoa2, d1bmoa3, d1bmob2, d1bmob3

Details for d1bmob1

PDB Entry: 1bmo (more details), 3.1 Å

PDB Description: bm-40, fs/ec domain pair

SCOP Domain Sequences for d1bmob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bmob1 a.39.1.3 (B:136-286) C-terminal (EC) domain of BM-40/SPARC/osteonectin {Human (Homo sapiens)}
ppcldseltefplrmrdwlknvlvtlyerdednnlltekqklrvkkihenekrleagdhp
vellardfeknynmyifpvhwqfgqldqhpidgylshtelaplraplipmehcttrffet
cdldndkyialdewagcfgikqkdidkdlvi

SCOP Domain Coordinates for d1bmob1:

Click to download the PDB-style file with coordinates for d1bmob1.
(The format of our PDB-style files is described here.)

Timeline for d1bmob1: