SCOPe 2.08: Domain d3abkr_: 3abk R:

Lineage for d3abkr_ (3abk R:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.11: Cytochrome c oxidase subunit E [48479] (2 families)
   automatically mapped to Pfam PF02284

5. Family a.118.11.1: Cytochrome c oxidase subunit E [48480] (2 proteins)

6. Protein Cytochrome c oxidase subunit E [48481] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [48482] (50 PDB entries)

8. Domain d3abkr_: 3abk R: [171937]
   Other proteins in same PDB: d3abka_, d3abkb1, d3abkb2, d3abkc_, d3abkd_, d3abkf_, d3abkg_, d3abkh_, d3abki_, d3abkj_, d3abkk_, d3abkl_, d3abkm_, d3abkn_, d3abko1, d3abko2, d3abkp_, d3abkq_, d3abks_, d3abkt_, d3abku_, d3abkv_, d3abkw_, d3abkx_, d3abky_, d3abkz_
   automated match to d1occe_
   complexed with cdl, chd, cu, cua, dmu, hea, mg, na, no, pek, pgv, psc, tgl, unx, zn

Details for d3abkr_

PDB Entry: 3abk, 2 Å

PDB Description: Bovine heart cytochrome c oxidase at the NO-bound fully reduced state (50K)

PDB Compounds: (R:) Cytochrome c oxidase subunit 5A

SCOPe Domain Sequences for d3abkr_:

Sequence; same for both SEQRES and ATOM records:

>d3abkr_ a.118.11.1 (R:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]}
hetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlndfasa
vrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv

Timeline for d3abkr_:

• d3abkr_ first appeared in SCOPe 2.01
  
• d3abkr_ appears in SCOPe 2.07