Lineage for d3abkk_ (3abk K:)

  1. Root: SCOPe 2.05
  2. 1955192Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1957421Fold f.23: Single transmembrane helix [81407] (40 superfamilies)
    not a true fold
  4. 1957660Superfamily f.23.5: Mitochondrial cytochrome c oxidase subunit VIIb [81423] (1 family) (S)
    automatically mapped to Pfam PF05392
  5. 1957661Family f.23.5.1: Mitochondrial cytochrome c oxidase subunit VIIb [81422] (2 proteins)
  6. 1957683Protein automated matches [190272] (1 species)
    not a true protein
  7. 1957684Species Cow (Bos taurus) [TaxId:9913] [187064] (18 PDB entries)
  8. 1957697Domain d3abkk_: 3abk K: [171931]
    Other proteins in same PDB: d3abka_, d3abkb1, d3abkb2, d3abkc_, d3abkd_, d3abke_, d3abkf_, d3abkg_, d3abkh_, d3abki_, d3abkj_, d3abkl_, d3abkm_, d3abkn_, d3abko1, d3abko2, d3abkp_, d3abkq_, d3abkr_, d3abks_, d3abkt_, d3abku_, d3abkv_, d3abkw_, d3abky_, d3abkz_
    automated match to d1occk_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, no, pek, pgv, psc, tgl, unx, zn

Details for d3abkk_

PDB Entry: 3abk (more details), 2 Å

PDB Description: Bovine heart cytochrome c oxidase at the NO-bound fully reduced state (50K)
PDB Compounds: (K:) Cytochrome c oxidase subunit 7B

SCOPe Domain Sequences for d3abkk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3abkk_ f.23.5.1 (K:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
apdfhdkygnavlasgatfcvavwvymatqigiewnpspvgrvtpkewr

SCOPe Domain Coordinates for d3abkk_:

Click to download the PDB-style file with coordinates for d3abkk_.
(The format of our PDB-style files is described here.)

Timeline for d3abkk_: