SCOPe 2.07: Domain d1bmoa1: 1bmo A:136-286

Lineage for d1bmoa1 (1bmo A:136-286)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.3: Osteonectin [47489] (1 protein)
   5 helices; two EF-hands plus one of additional helices in the N-terminal part

6. Protein C-terminal (EC) domain of BM-40/SPARC/osteonectin [47490] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47491] (3 PDB entries)

8. Domain d1bmoa1: 1bmo A:136-286 [17193]
   Other proteins in same PDB: d1bmoa2, d1bmoa3, d1bmob2, d1bmob3
   complexed with ca

Details for d1bmoa1

PDB Entry: 1bmo, 3.1 Å

PDB Description: bm-40, fs/ec domain pair

PDB Compounds: (A:) bm-40

SCOPe Domain Sequences for d1bmoa1:

Sequence; same for both SEQRES and ATOM records:

>d1bmoa1 a.39.1.3 (A:136-286) C-terminal (EC) domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]}
ppcldseltefplrmrdwlknvlvtlyerdednnlltekqklrvkkihenekrleagdhp
vellardfeknynmyifpvhwqfgqldqhpidgylshtelaplraplipmehcttrffet
cdldndkyialdewagcfgikqkdidkdlvi

Timeline for d1bmoa1:

• d1bmoa1 first appeared (with stable ids) in SCOP 1.55
  
• d1bmoa1 appears in SCOPe 2.06
  
• d1bmoa1 appears in the current release, SCOPe 2.08