Lineage for d3abkf_ (3abk F:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3036286Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 3036508Superfamily g.41.5: Rubredoxin-like [57802] (4 families) (S)
  5. 3036679Family g.41.5.3: Cytochrome c oxidase Subunit F [57818] (2 proteins)
    membrane-anchored rubredoxin-like domain
    automatically mapped to Pfam PF01215
  6. 3036680Protein Cytochrome c oxidase Subunit F [57819] (1 species)
  7. 3036681Species Cow (Bos taurus) [TaxId:9913] [57820] (50 PDB entries)
  8. 3036700Domain d3abkf_: 3abk F: [171926]
    Other proteins in same PDB: d3abka_, d3abkb1, d3abkb2, d3abkc_, d3abkd_, d3abke_, d3abkg_, d3abkh_, d3abki_, d3abkj_, d3abkk_, d3abkl_, d3abkm_, d3abkn_, d3abko1, d3abko2, d3abkp_, d3abkq_, d3abkr_, d3abkt_, d3abku_, d3abkv_, d3abkw_, d3abkx_, d3abky_, d3abkz_
    automated match to d1occf_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, no, pek, pgv, psc, tgl, unx, zn

Details for d3abkf_

PDB Entry: 3abk (more details), 2 Å

PDB Description: Bovine heart cytochrome c oxidase at the NO-bound fully reduced state (50K)
PDB Compounds: (F:) Cytochrome c oxidase subunit 5B

SCOPe Domain Sequences for d3abkf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3abkf_ g.41.5.3 (F:) Cytochrome c oxidase Subunit F {Cow (Bos taurus) [TaxId: 9913]}
asgggvptdeeqatglerevmlaarkgqdpynilapkatsgtkedpnlvpsitnkrivgc
iceednstviwfwlhkgeaqrcpscgthyklvphqlah

SCOPe Domain Coordinates for d3abkf_:

Click to download the PDB-style file with coordinates for d3abkf_.
(The format of our PDB-style files is described here.)

Timeline for d3abkf_: