SCOPe 2.08: Domain d3abkc_: 3abk C:

Lineage for d3abkc_ (3abk C:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.25: Cytochrome c oxidase subunit III-like [81453] (1 superfamily)
   core: 7 transmembrane helices organized into two bundles, one formed by the first two helices and the other by the rest

4. Superfamily f.25.1: Cytochrome c oxidase subunit III-like [81452] (2 families)
   automatically mapped to Pfam PF00510

5. Family f.25.1.1: Cytochrome c oxidase subunit III-like [81451] (3 proteins)
   function unknown, possibly involved in the assembly or form the entrance to "oxygen" channel

6. Protein Mitochondrial cytochrome c oxidase, subunit III [81445] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [81444] (57 PDB entries)

8. Domain d3abkc_: 3abk C: [171923]
   Other proteins in same PDB: d3abka_, d3abkb1, d3abkb2, d3abkd_, d3abke_, d3abkf_, d3abkg_, d3abkh_, d3abki_, d3abkj_, d3abkk_, d3abkl_, d3abkm_, d3abkn_, d3abko1, d3abko2, d3abkq_, d3abkr_, d3abks_, d3abkt_, d3abku_, d3abkv_, d3abkw_, d3abkx_, d3abky_, d3abkz_
   automated match to d1occc_
   complexed with cdl, chd, cu, cua, dmu, hea, mg, na, no, pek, pgv, psc, tgl, unx, zn

Details for d3abkc_

PDB Entry: 3abk, 2 Å

PDB Description: Bovine heart cytochrome c oxidase at the NO-bound fully reduced state (50K)

PDB Compounds: (C:) Cytochrome c oxidase subunit 3

SCOPe Domain Sequences for d3abkc_:

Sequence; same for both SEQRES and ATOM records:

>d3abkc_ f.25.1.1 (C:) Mitochondrial cytochrome c oxidase, subunit III {Cow (Bos taurus) [TaxId: 9913]}
hqthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrdvi
restfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptgih
plnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqaseyy
eapftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeaaawyw
hfvdvvwlflyvsiywwgs

Timeline for d3abkc_:

• d3abkc_ first appeared in SCOPe 2.01
  
• d3abkc_ appears in SCOPe 2.07