![]() | Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
![]() | Fold f.24: Cytochrome c oxidase subunit I-like [81443] (1 superfamily) 12 transmembrane helices in an approximate threefold rotational symmetric arrangement |
![]() | Superfamily f.24.1: Cytochrome c oxidase subunit I-like [81442] (1 family) ![]() |
![]() | Family f.24.1.1: Cytochrome c oxidase subunit I-like [81441] (5 proteins) the largest and best conserved subunit, contains two heme groups, low spin heme a and high spin heme a3 |
![]() | Protein automated matches [190134] (3 species) not a true protein |
![]() | Species Cow (Bos taurus) [TaxId:9913] [187061] (18 PDB entries) |
![]() | Domain d3abka_: 3abk A: [171922] Other proteins in same PDB: d3abkb1, d3abkb2, d3abkc_, d3abkd_, d3abke_, d3abkf_, d3abkg_, d3abkh_, d3abki_, d3abkj_, d3abkk_, d3abkl_, d3abkm_, d3abko1, d3abko2, d3abkp_, d3abkq_, d3abkr_, d3abks_, d3abkt_, d3abku_, d3abkv_, d3abkw_, d3abkx_, d3abky_, d3abkz_ automated match to d1occa_ complexed with cdl, chd, cu, cua, dmu, hea, mg, na, no, pek, pgv, psc, tgl, unx, zn |
PDB Entry: 3abk (more details), 2 Å
SCOPe Domain Sequences for d3abka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3abka_ f.24.1.1 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]} mfinrwlfstnhkdigtlyllfgawagmvgtalslliraelgqpgtllgddqiynvvvta hafvmiffmvmpimiggfgnwlvplmigapdmafprmnnmsfwllppsfllllassmvea gagtgwtvypplagnlahagasvdltifslhlagvssilgainfittiinmkppamsqyq tplfvwsvmitavllllslpvlaagitmlltdrnlnttffdpagggdpilyqhlfwffgh pevyililpgfgmishivtyysgkkepfgymgmvwammsigflgfivwahhmftvgmdvd trayftsatmiiaiptgvkvfswlatlhggnikwspammwalgfiflftvggltgivlan ssldivlhdtyyvvahfhyvlsmgavfaimggfvhwfplfsgytlndtwakihfaimfvg vnmtffpqhflglsgmprrysdypdaytmwntissmgsfisltavmlmvfiiweafaskr evltvdltttnlewlngcpppyhtfeeptyvnlk
Timeline for d3abka_:
![]() Domains from other chains: (mouse over for more information) d3abkb1, d3abkb2, d3abkc_, d3abkd_, d3abke_, d3abkf_, d3abkg_, d3abkh_, d3abki_, d3abkj_, d3abkk_, d3abkl_, d3abkm_, d3abkn_, d3abko1, d3abko2, d3abkp_, d3abkq_, d3abkr_, d3abks_, d3abkt_, d3abku_, d3abkv_, d3abkw_, d3abkx_, d3abky_, d3abkz_ |