Lineage for d1nubb1 (1nub B:136-286)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 213166Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 213167Superfamily a.39.1: EF-hand [47473] (9 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 213278Family a.39.1.3: Osteonectin [47489] (1 protein)
    5 helices; two EF-hands plus one of additional helices in the N-terminal part
  6. 213279Protein C-terminal (EC) domain of BM-40/SPARC/osteonectin [47490] (1 species)
  7. 213280Species Human (Homo sapiens) [TaxId:9606] [47491] (3 PDB entries)
  8. 213283Domain d1nubb1: 1nub B:136-286 [17192]
    Other proteins in same PDB: d1nuba2, d1nuba3, d1nubb2, d1nubb3
    complexed with ca, nag; mutant

Details for d1nubb1

PDB Entry: 1nub (more details), 2.8 Å

PDB Description: helix c deletion mutant of bm-40 fs-ec domain pair

SCOP Domain Sequences for d1nubb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nubb1 a.39.1.3 (B:136-286) C-terminal (EC) domain of BM-40/SPARC/osteonectin {Human (Homo sapiens)}
ppcldseltefplrmrdwlknvlvtlyerdednnlltekqklrvkkihenekrleagdhp
eknynmyifpvhwqfgqldqhpidgylshtelaplraplipmehcttrffetcdldndky
ialdewagcfgikqkdidkdlvi

SCOP Domain Coordinates for d1nubb1:

Click to download the PDB-style file with coordinates for d1nubb1.
(The format of our PDB-style files is described here.)

Timeline for d1nubb1: