Lineage for d1nubb1 (1nub B:136-286)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 47511Fold a.39: EF Hand-like [47472] (3 superfamilies)
  4. 47512Superfamily a.39.1: EF-hand [47473] (8 families) (S)
  5. 47576Family a.39.1.3: Osteonectin [47489] (1 protein)
  6. 47577Protein C-terminal (EC) domain of BM-40/SPARC/osteonectin [47490] (1 species)
  7. 47578Species Human (Homo sapiens) [TaxId:9606] [47491] (3 PDB entries)
  8. 47581Domain d1nubb1: 1nub B:136-286 [17192]
    Other proteins in same PDB: d1nuba2, d1nuba3, d1nubb2, d1nubb3

Details for d1nubb1

PDB Entry: 1nub (more details), 2.8 Å

PDB Description: helix c deletion mutant of bm-40 fs-ec domain pair

SCOP Domain Sequences for d1nubb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nubb1 a.39.1.3 (B:136-286) C-terminal (EC) domain of BM-40/SPARC/osteonectin {Human (Homo sapiens)}
ppcldseltefplrmrdwlknvlvtlyerdednnlltekqklrvkkihenekrleagdhp
eknynmyifpvhwqfgqldqhpidgylshtelaplraplipmehcttrffetcdldndky
ialdewagcfgikqkdidkdlvi

SCOP Domain Coordinates for d1nubb1:

Click to download the PDB-style file with coordinates for d1nubb1.
(The format of our PDB-style files is described here.)

Timeline for d1nubb1: