Lineage for d3abfd_ (3abf D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2960762Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
    (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet
    generally forms trimers with three closely packed beta-sheets
  4. 2960763Superfamily d.80.1: Tautomerase/MIF [55331] (7 families) (S)
  5. 2961445Family d.80.1.0: automated matches [191533] (1 protein)
    not a true family
  6. 2961446Protein automated matches [190903] (22 species)
    not a true protein
  7. 2961600Species Thermus thermophilus HB8 [TaxId:300852] [189563] (1 PDB entry)
  8. 2961604Domain d3abfd_: 3abf D: [171919]
    automated match to d1bjpa_
    complexed with so4

Details for d3abfd_

PDB Entry: 3abf (more details), 1.94 Å

PDB Description: crystal structure of a 4-oxalocrotonate tautomerase homologue (tthb242)
PDB Compounds: (D:) 4-oxalocrotonate tautomerase

SCOPe Domain Sequences for d3abfd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3abfd_ d.80.1.0 (D:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mvvlkvtllegrppekkrelvrrltemasrllgepyeevrvilyevrrdqwaaggvlfsd
ke

SCOPe Domain Coordinates for d3abfd_:

Click to download the PDB-style file with coordinates for d3abfd_.
(The format of our PDB-style files is described here.)

Timeline for d3abfd_: