![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.80: Tautomerase/MIF [55330] (1 superfamily) (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet generally forms trimers with three closely packed beta-sheets |
![]() | Superfamily d.80.1: Tautomerase/MIF [55331] (7 families) ![]() |
![]() | Family d.80.1.0: automated matches [191533] (1 protein) not a true family |
![]() | Protein automated matches [190903] (8 species) not a true protein |
![]() | Species Thermus thermophilus [TaxId:300852] [189563] (1 PDB entry) |
![]() | Domain d3abfc_: 3abf C: [171918] automated match to d1bjpa_ complexed with so4 |
PDB Entry: 3abf (more details), 1.94 Å
SCOPe Domain Sequences for d3abfc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3abfc_ d.80.1.0 (C:) automated matches {Thermus thermophilus [TaxId: 300852]} mvvlkvtllegrppekkrelvrrltemasrllgepyeevrvilyevrrdqwaaggvlfsd keg
Timeline for d3abfc_: