Lineage for d3abba1 (3abb A:11-404)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (63 species)
    not a true protein
  7. 2005886Species Streptomyces avermitilis [TaxId:33903] [189294] (7 PDB entries)
  8. 2005889Domain d3abba1: 3abb A:11-404 [171915]
    Other proteins in same PDB: d3abba2
    automated match to d1cmna_
    complexed with hem

Details for d3abba1

PDB Entry: 3abb (more details), 2.3 Å

PDB Description: Crystal structure of CYP105D6
PDB Compounds: (A:) Cytochrome P450 hydroxylase

SCOPe Domain Sequences for d3abba1:

Sequence, based on SEQRES records: (download)

>d3abba1 a.104.1.0 (A:11-404) automated matches {Streptomyces avermitilis [TaxId: 33903]}
spapsfpqdrtcpyqppkayeerrgespltqvtlfdgrpawlitghaegrallvdprlss
dwghpdfpvvvrrtedrgglafpligvddpvharqrrmlipsfgvkrmnairprlqslvd
rllddmlakgpgadlvsafalpvpsvaicellgvpygdhdffeecsrnfvgaatsaeada
afgelytylhglvgrkqaepedglldeliarqleegdldhdevvmialvllvaghettvn
aialgaltliqhpeqidvllrdpgavsgvveellrftsvsdhivrmakedievggatika
gdavlvsitlmnrdakayenpdifdarrnarhhvgfghgihqclgqnlaraeleialggl
faripglrlavpldevpikaghdaqgpielpvvw

Sequence, based on observed residues (ATOM records): (download)

>d3abba1 a.104.1.0 (A:11-404) automated matches {Streptomyces avermitilis [TaxId: 33903]}
spapsfpqdrtcpyqppkayeerrgespltqvtlfdgrpawlitghaegrallvdprlss
dwghpdfpvvvafpligvddpvharqrrmlipsfgvkrmnairprlqslvdrllddmlak
gpgadlvsafalpvpsvaicellgvpygdhdffeecsrnfveadaafgelytylhglvgr
kqaepedglldeliarqleegdldhdevvmialvllvaghettvnaialgaltliqhpeq
idvllrdpgavsgvveellrftsvsdhivrmakedievggatikagdavlvsitlmnrda
kayenpdifdarrnarhhvgfghgihqclgqnlaraeleialgglfaripglrlavplde
vpikaghdaqgpielpvvw

SCOPe Domain Coordinates for d3abba1:

Click to download the PDB-style file with coordinates for d3abba1.
(The format of our PDB-style files is described here.)

Timeline for d3abba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3abba2