Lineage for d3ab9a_ (3ab9 A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1808932Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 1808933Superfamily b.84.1: Single hybrid motif [51230] (2 families) (S)
    7 to 8 strands in 2 beta-sheets
  5. 1808934Family b.84.1.1: Biotinyl/lipoyl-carrier proteins and domains [51231] (7 proteins)
  6. 1808979Protein Protein H of glycine cleavage system [51236] (4 species)
  7. 1808980Species Escherichia coli K-12 [TaxId:83333] [189182] (6 PDB entries)
  8. 1808982Domain d3ab9a_: 3ab9 A: [171914]
    automated match to d1onla_
    complexed with ca, cl

Details for d3ab9a_

PDB Entry: 3ab9 (more details), 1.65 Å

PDB Description: Crystal Structure of lipoylated E. coli H-protein (reduced form)
PDB Compounds: (A:) glycine cleavage system H protein

SCOPe Domain Sequences for d3ab9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ab9a_ b.84.1.1 (A:) Protein H of glycine cleavage system {Escherichia coli K-12 [TaxId: 83333]}
nvpaelkyskehewlrkeadgtytvgitehaqellgdmvfvdlpevgatvsagddcavae
svkaasdiyapvsgeivavndalsdspelvnsepyaggwifkikasdeseleslldatay
eallede

SCOPe Domain Coordinates for d3ab9a_:

Click to download the PDB-style file with coordinates for d3ab9a_.
(The format of our PDB-style files is described here.)

Timeline for d3ab9a_: