Lineage for d1nuba1 (1nub A:136-286)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1996349Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1996350Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1996743Family a.39.1.3: Osteonectin [47489] (1 protein)
    5 helices; two EF-hands plus one of additional helices in the N-terminal part
  6. 1996744Protein C-terminal (EC) domain of BM-40/SPARC/osteonectin [47490] (1 species)
  7. 1996745Species Human (Homo sapiens) [TaxId:9606] [47491] (3 PDB entries)
  8. 1996747Domain d1nuba1: 1nub A:136-286 [17191]
    Other proteins in same PDB: d1nuba2, d1nuba3, d1nubb2, d1nubb3
    complexed with ca; mutant

Details for d1nuba1

PDB Entry: 1nub (more details), 2.8 Å

PDB Description: helix c deletion mutant of bm-40 fs-ec domain pair
PDB Compounds: (A:) basement membrane protein bm-40

SCOPe Domain Sequences for d1nuba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nuba1 a.39.1.3 (A:136-286) C-terminal (EC) domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]}
ppcldseltefplrmrdwlknvlvtlyerdednnlltekqklrvkkihenekrleagdhp
eknynmyifpvhwqfgqldqhpidgylshtelaplraplipmehcttrffetcdldndky
ialdewagcfgikqkdidkdlvi

SCOPe Domain Coordinates for d1nuba1:

Click to download the PDB-style file with coordinates for d1nuba1.
(The format of our PDB-style files is described here.)

Timeline for d1nuba1: