![]() | Class a: All alpha proteins [46456] (138 folds) |
![]() | Fold a.39: EF Hand-like [47472] (3 superfamilies) |
![]() | Superfamily a.39.1: EF-hand [47473] (7 families) ![]() |
![]() | Family a.39.1.3: Osteonectin [47489] (1 protein) |
![]() | Protein C-terminal (EC) domain of BM-40/SPARC/osteonectin [47490] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [47491] (3 PDB entries) |
![]() | Domain d1nuba1: 1nub A:136-286 [17191] Other proteins in same PDB: d1nuba2, d1nuba3, d1nubb2, d1nubb3 |
PDB Entry: 1nub (more details), 2.8 Å
SCOP Domain Sequences for d1nuba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nuba1 a.39.1.3 (A:136-286) C-terminal (EC) domain of BM-40/SPARC/osteonectin {Human (Homo sapiens)} ppcldseltefplrmrdwlknvlvtlyerdednnlltekqklrvkkihenekrleagdhp eknynmyifpvhwqfgqldqhpidgylshtelaplraplipmehcttrffetcdldndky ialdewagcfgikqkdidkdlvi
Timeline for d1nuba1: