SCOPe 2.03: Domain d3aala_: 3aal A:

Lineage for d3aala_ (3aal A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.15: Xylose isomerase-like [51658] (8 families)
   different families share similar but non-identical metal-binding sites

5. Family c.1.15.1: Endonuclease IV [51659] (2 proteins)

6. Protein automated matches [191204] (2 species)
   not a true protein

7. Species Geobacillus kaustophilus [TaxId:1462] [189546] (1 PDB entry)

8. Domain d3aala_: 3aal A: [171907]
   automated match to d1xp3a1
   complexed with cac, fe, zn

Details for d3aala_

PDB Entry: 3aal, 1.6 Å

PDB Description: crystal structure of endonuclease iv from geobacillus kaustophilus

PDB Compounds: (A:) Probable endonuclease 4

SCOPe Domain Sequences for d3aala_:

Sequence; same for both SEQRES and ATOM records:

>d3aala_ c.1.15.1 (A:) automated matches {Geobacillus kaustophilus [TaxId: 1462]}
lkigshvsmsgkkmllaaseeaasygantfmiytgapqntkrksieelnieagrqhmqah
gieeivvhapyiinignttnldtfslgvdflraeierteaigakqlvlhpgahvgagvea
glrqiirglnevltreqnvqialetmagkgsecgrtfeelayiidgvayndklsvcfdtc
hthdagydivndfdgvleefdriiglgrlkvlhindsknprgsrkdrhenigfghigfaa
lnyivhhpqledipkiletpyvgedknnkkppykheiamlraqsfddqllekinagae

Timeline for d3aala_:

• d3aala_ first appeared in SCOPe 2.01
  
• d3aala_ appears in SCOPe 2.02
  
• d3aala_ appears in SCOPe 2.04
  
• d3aala_ appears in the current release, SCOPe 2.08