| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.15: Xylose isomerase-like [51658] (8 families) ![]() different families share similar but non-identical metal-binding sites |
| Family c.1.15.1: Endonuclease IV [51659] (2 proteins) |
| Protein automated matches [191204] (2 species) not a true protein |
| Species Geobacillus kaustophilus [TaxId:1462] [189546] (1 PDB entry) |
| Domain d3aala_: 3aal A: [171907] automated match to d1xp3a1 complexed with cac, fe, zn |
PDB Entry: 3aal (more details), 1.6 Å
SCOPe Domain Sequences for d3aala_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3aala_ c.1.15.1 (A:) automated matches {Geobacillus kaustophilus [TaxId: 1462]}
lkigshvsmsgkkmllaaseeaasygantfmiytgapqntkrksieelnieagrqhmqah
gieeivvhapyiinignttnldtfslgvdflraeierteaigakqlvlhpgahvgagvea
glrqiirglnevltreqnvqialetmagkgsecgrtfeelayiidgvayndklsvcfdtc
hthdagydivndfdgvleefdriiglgrlkvlhindsknprgsrkdrhenigfghigfaa
lnyivhhpqledipkiletpyvgedknnkkppykheiamlraqsfddqllekinagae
Timeline for d3aala_: