Lineage for d3aala_ (3aal A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2839044Superfamily c.1.15: Xylose isomerase-like [51658] (8 families) (S)
    different families share similar but non-identical metal-binding sites
  5. 2839045Family c.1.15.1: Endonuclease IV [51659] (2 proteins)
  6. 2839056Protein automated matches [191204] (2 species)
    not a true protein
  7. 2839060Species Geobacillus kaustophilus [TaxId:1462] [189546] (1 PDB entry)
  8. 2839061Domain d3aala_: 3aal A: [171907]
    automated match to d1xp3a1
    complexed with cac, fe, zn

Details for d3aala_

PDB Entry: 3aal (more details), 1.6 Å

PDB Description: crystal structure of endonuclease iv from geobacillus kaustophilus
PDB Compounds: (A:) Probable endonuclease 4

SCOPe Domain Sequences for d3aala_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3aala_ c.1.15.1 (A:) automated matches {Geobacillus kaustophilus [TaxId: 1462]}
lkigshvsmsgkkmllaaseeaasygantfmiytgapqntkrksieelnieagrqhmqah
gieeivvhapyiinignttnldtfslgvdflraeierteaigakqlvlhpgahvgagvea
glrqiirglnevltreqnvqialetmagkgsecgrtfeelayiidgvayndklsvcfdtc
hthdagydivndfdgvleefdriiglgrlkvlhindsknprgsrkdrhenigfghigfaa
lnyivhhpqledipkiletpyvgedknnkkppykheiamlraqsfddqllekinagae

SCOPe Domain Coordinates for d3aala_:

Click to download the PDB-style file with coordinates for d3aala_.
(The format of our PDB-style files is described here.)

Timeline for d3aala_: