SCOPe 2.01: Domain d3aa9b_: 3aa9 B:

Lineage for d3aa9b_ (3aa9 B:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.5: GlnB-like [54913] (6 families)
   form timeric structures with the orthogonally packed beta-sheets

5. Family d.58.5.2: Divalent ion tolerance proteins CutA (CutA1) [75434] (4 proteins)

6. Protein Cut A1 [89931] (5 species)

7. Species Escherichia coli [TaxId:562] [102973] (4 PDB entries)

8. Domain d3aa9b_: 3aa9 B: [171902]
   automated match to d1naqa_
   mutant

Details for d3aa9b_

PDB Entry: 3aa9, 2.3 Å

PDB Description: Crystal Structure Analysis of the Mutant CutA1 (E61V) from E. coli

PDB Compounds: (B:) Divalent-cation tolerance protein cutA

SCOPe Domain Sequences for d3aa9b_:

Sequence; same for both SEQRES and ATOM records:

>d3aa9b_ d.58.5.2 (B:) Cut A1 {Escherichia coli [TaxId: 562]}
tasvvvlctapdeataqdlaakvlaeklaacatlipgatslyywegkleqeyvvqmilkt
tvshqqalleclkshhpyqtpellvlpvthgdtdylswlnasl

Timeline for d3aa9b_:

• d3aa9b_ is new in SCOPe 2.01-stable
  
• d3aa9b_ appears in SCOPe 2.02
  
• d3aa9b_ appears in the current release, SCOPe 2.08