| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.5: GlnB-like [54913] (6 families) ![]() form timeric structures with the orthogonally packed beta-sheets |
| Family d.58.5.2: Divalent ion tolerance proteins CutA (CutA1) [75434] (4 proteins) |
| Protein Cut A1 [89931] (5 species) |
| Species Escherichia coli [TaxId:562] [102973] (5 PDB entries) |
| Domain d3aa9b_: 3aa9 B: [171902] automated match to d1naqa_ mutant |
PDB Entry: 3aa9 (more details), 2.3 Å
SCOPe Domain Sequences for d3aa9b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3aa9b_ d.58.5.2 (B:) Cut A1 {Escherichia coli [TaxId: 562]}
tasvvvlctapdeataqdlaakvlaeklaacatlipgatslyywegkleqeyvvqmilkt
tvshqqalleclkshhpyqtpellvlpvthgdtdylswlnasl
Timeline for d3aa9b_: