Lineage for d3aa9a_ (3aa9 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2950563Superfamily d.58.5: GlnB-like [54913] (6 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 2950720Family d.58.5.2: Divalent ion tolerance proteins CutA (CutA1) [75434] (4 proteins)
  6. 2950721Protein Cut A1 [89931] (5 species)
  7. 2950724Species Escherichia coli [TaxId:562] [102973] (5 PDB entries)
  8. 2950734Domain d3aa9a_: 3aa9 A: [171901]
    automated match to d1naqa_
    mutant

Details for d3aa9a_

PDB Entry: 3aa9 (more details), 2.3 Å

PDB Description: Crystal Structure Analysis of the Mutant CutA1 (E61V) from E. coli
PDB Compounds: (A:) Divalent-cation tolerance protein cutA

SCOPe Domain Sequences for d3aa9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3aa9a_ d.58.5.2 (A:) Cut A1 {Escherichia coli [TaxId: 562]}
tasvvvlctapdeataqdlaakvlaeklaacatlipgatslyywegkleqeyvvqmilkt
tvshqqalleclkshhpyqtpellvlpvthgdtdylswlnaslr

SCOPe Domain Coordinates for d3aa9a_:

Click to download the PDB-style file with coordinates for d3aa9a_.
(The format of our PDB-style files is described here.)

Timeline for d3aa9a_: