Lineage for d1sra__ (1sra -)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 537532Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 537533Superfamily a.39.1: EF-hand [47473] (10 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 537660Family a.39.1.3: Osteonectin [47489] (1 protein)
    5 helices; two EF-hands plus one of additional helices in the N-terminal part
  6. 537661Protein C-terminal (EC) domain of BM-40/SPARC/osteonectin [47490] (1 species)
  7. 537662Species Human (Homo sapiens) [TaxId:9606] [47491] (3 PDB entries)
  8. 537663Domain d1sra__: 1sra - [17190]
    this domain only
    complexed with ca

Details for d1sra__

PDB Entry: 1sra (more details), 2 Å

PDB Description: structure of a novel extracellular ca2+-binding module in bm-40(slash)sparc(slash)osteonectin

SCOP Domain Sequences for d1sra__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sra__ a.39.1.3 (-) C-terminal (EC) domain of BM-40/SPARC/osteonectin {Human (Homo sapiens)}
ppcldseltefplrmrdwlknvlvtlyerdednnlltekqklrvkkihenekrleagdhp
vellardfeknynmyifpvhwqfgqldqhpidgylshtelaplraplipmehcttrffet
cdldndkyialdewagcfgikqkdidkdlvi

SCOP Domain Coordinates for d1sra__:

Click to download the PDB-style file with coordinates for d1sra__.
(The format of our PDB-style files is described here.)

Timeline for d1sra__: